PDB entry 1lsy

View 1lsy on RCSB PDB site
Description: crystal structure of the mutant d52s hen egg white lysozyme with an oligosaccharide product
Deposited on 1994-09-27, released 1995-01-26
The last revision prior to the SCOP 1.63 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1lsy__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lsy_ (-)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstsygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl