PDB entry 1lsw

View 1lsw on RCSB PDB site
Description: Crystal structure of the ferrous BjFixL heme domain
Class: transferase
Keywords: PAS fold
Deposited on 2002-05-20, released 2002-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor protein fixl
    Species: Bradyrhizobium japonicum
    Gene: fixL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lswa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lswA (A:)
    mrethlrsilhtipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsr
    hdsyisryrttsdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh
    qqtqarlqelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lswA (A:)
    damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
    hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq