PDB entry 1lsu

View 1lsu on RCSB PDB site
Description: KTN Bsu222 Crystal Structure in Complex with NADH
Class: transport protein
Keywords: KTN domain, NAD, RCK domain, Potassium Transport, Potassium Channel, KtrA, Rossmann Fold, TRANSPORT PROTEIN
Deposited on 2002-05-18, released 2002-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.8499999999999996 Å
R-factor: 0.279
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conserved hypothetical protein yuaA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: KtrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32080
      • engineered (25)
    Domains in SCOPe 2.08: d1lsua_
  • Chain 'B':
    Compound: Conserved hypothetical protein yuaA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: KtrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32080
      • engineered (25)
    Domains in SCOPe 2.08: d1lsub_
  • Heterogens: NAI

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lsuA (A:)
    gshgmgriknkqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavian
    ateenellslgirnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvleki
    gadriihpekdmgvkiaqslsdenvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lsuA (A:)
    kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
    girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
    dmgvkiaqslsden
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lsuB (B:)
    gshgmgriknkqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavian
    ateenellslgirnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvleki
    gadriihpekdmgvkiaqslsdenvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lsuB (B:)
    kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
    girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
    dmgvkiaqslsden