PDB entry 1lsp

View 1lsp on RCSB PDB site
Description: the crystal structure of a bulgecin-inhibited g-type lysozyme from the egg-white of the australian black swan. a comparison of the binding of bulgecin to three muramidases
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-02-09, released 1996-01-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.175
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Cygnus atratus [TaxId:8868]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00717 (0-184)
  Domains in SCOPe 2.06: d1lspa_
• Heterogens: BUL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lspA (A:)
  rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
  vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
  tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
  kqhgy