PDB entry 1lso

View 1lso on RCSB PDB site
Description: Crystal Structure of the S137A mutant of L-3-Hydroxyacyl-CoA Dehydrogenase in Complex with NAD
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2002-05-17, released 2004-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HCDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16836 (Start-301)
      • engineered (136)
    Domains in SCOPe 2.07: d1lsoa1, d1lsoa2
  • Chain 'B':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HCDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16836 (Start-301)
      • engineered (136)
    Domains in SCOPe 2.07: d1lsob1, d1lsob2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lsoA (A:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfk
    rldkfaaehtifasntaslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lsoA (A:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
    fasntaslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lsoB (B:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfk
    rldkfaaehtifasntaslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lsoB (B:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
    fasntaslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk