PDB entry 1lsn

View 1lsn on RCSB PDB site
Description:
Deposited on 1994-09-13, released 1994-11-30
The last revision prior to the SCOP 1.63 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.15
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1lsn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lsn_ (-)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditaavncakkivsngngmnawvawrnrckgtdv
    qawirgcrl