PDB entry 1lsm

View 1lsm on RCSB PDB site
Description: thermal stability determinants of chicken egg-white lysozyme core mutants: hydrophobicity, packing volume and conserved buried water molecules
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1994-09-13, released 1994-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.16
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hen egg white lysozyme
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • conflict (54)
      • conflict (90)
      • conflict (100)
    Domains in SCOPe 2.06: d1lsma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lsmA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygllqins
    rwwcndgrtpgsrnlcnipcsallssditatvncakkivssgngmnawvawrnrckgtdv
    qawirgcrl