PDB entry 1lsl

View 1lsl on RCSB PDB site
Description: Crystal Structure of the Thrombospondin-1 Type 1 Repeats
Class: cell adhesion
Keywords: tsp-1, tsr, cell adhesion
Deposited on 2002-05-17, released 2002-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.238
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombospondin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: THBS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lsla1, d1lsla2
  • Heterogens: FUL, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lslA (A:)
qdggwshwspwsscsvtcgdgvitrirlcnspspqmngkpcegearetkackkdacping
gwgpwspwdicsvtcgggvqkrsrlcnnptpqfggkdcvgdvtenqicnkqdc