PDB entry 1lsj

View 1lsj on RCSB PDB site
Description: Crystal Structure of the E110Q Mutant of L-3-Hydroxyacyl-CoA Dehydrogenase in Complex with NAD
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2002-05-17, released 2004-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HCDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16836 (Start-301)
      • engineered (109)
    Domains in SCOPe 2.07: d1lsja1, d1lsja2
  • Chain 'B':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HCDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16836 (Start-301)
      • engineered (109)
    Domains in SCOPe 2.07: d1lsjb1, d1lsjb2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lsjA (A:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdefvektlstiatstdaasvvhstdlvveaivqnlkvknelfk
    rldkfaaehtifasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lsjA (A:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdefvektlstiatstdaasvvhstdlvveaivqnlkvknelfkrldkfaaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lsjB (B:)
    sssstasasakkiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgiee
    slrkvakkkfaenpkagdefvektlstiatstdaasvvhstdlvveaivqnlkvknelfk
    rldkfaaehtifasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqk
    tfeslvdfskalgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklga
    gypmgpfelldyvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfyk
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lsjB (B:)
    kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
    enpkagdefvektlstiatstdaasvvhstdlvveaivqnlkvknelfkrldkfaaehti
    fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
    lgkhpvsckdtpgfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelld
    yvgldttkfivdgwhemdaenplhqpspslnklvaenkfgkktgegfykyk