PDB entry 1lsh

View 1lsh on RCSB PDB site
Description: lipid-protein interactions in lipovitellin
Class: lipid binding protein
Keywords: lipovitellin, vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein b, apob, microsomal triglyceride transfer pr boundary lipid, phospholipid structure, lipid binding protein
Deposited on 2002-05-17, released 2002-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipovitellin (lv-1n, lv-1c)
    Species: Ichthyomyzon unicuspis [TaxId:30308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91062 (0-1054)
      • conflict (71)
      • conflict (379)
      • conflict (400)
      • conflict (452)
      • conflict (765)
      • conflict (817)
      • conflict (995)
      • conflict (1046)
    Domains in SCOPe 2.07: d1lsha1, d1lsha2, d1lsha3
  • Chain 'B':
    Compound: lipovitellin (lv-2)
    Species: Ichthyomyzon unicuspis [TaxId:30308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91062
      • conflict (167)
      • conflict (183)
    Domains in SCOPe 2.07: d1lshb_
  • Heterogens: PLD, UPL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lshA (A:)
    efqpgkvyrysydafsisglpepgvnraglsgemkieihghthnqatlkitqvnlkyflg
    pwpsdsfypltggydhfiqqlevpvrfdysagrigdiyappqvtdtavnivrgilnlfql
    slkknqqtfelqetgvegicqttyvvqegyrtnemavvktkdlnncdhkvyktmgtayae
    rcptcqkmnknlrstavynyaifdepsgyiiksahseeiqqlsvfdikegnvviesrqkl
    ilegiqsapaasqaaslqnrgglmykfpssaitkmsslfvtkgknleseihtvlkhlven
    nqlsvhedapakflrltaflrnvdagvlqsiwhklhqqkdyrrwildavpamatseallf
    lkrtlaseqltsaeatqivastlsnqqatreslsyarellntsfirnrpilrktavlgyg
    slvfrycantvscpdellqplhdllsqssdrakeeeivlalkalgnagqpnsikkiqrfl
    pgqgksldeystrvqaeaimalrniakrdprkvqeivlpiflnvaikselrirscivffe
    skpsvalvsmvavrlrrepnlqvasfvysqmrslsrssnpefrdvaaacsvaikmlgskl
    drlgcryskavhvdtfnartmagvsadyfrinspsgplpravaakirgqgmgyasdivef
    glraeglqellyrgsqeqdaygtaldrqtllrsgqarshvssihdtlrklsdwksvpeer
    plasgyvkvhgqevvfaeldkkmmqrisqlwhsarshhaaaqeqigavvskleqgmdvll
    tkgyvvsevrymqpvcigipmdlnllvsgvttnranlsasfsslpadmkladllatniel
    rvaattsmsqhavaimglttdlakagmqthyktsaglgvngkiemnaresnfkaslkpfq
    qktvvvlstmesivfvrdpsgsrilpvlppkmtldkglisqqqqqphhqqqphqhgqdqa
    raayqrpwashefspaeqkqihdimtarpvmrrkqscsksaalsskvcfsarlrnaafir
    nallykitgdyvskvyvqptsskaqitkvelelqag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lshA (A:)
    efqpgkvyrysydafsisglpepgvnraglsgemkieihghthnqatlkitqvnlkyflg
    pwpsdsfypltggydhfiqqlevpvrfdysagrigdiyappqvtdtavnivrgilnlfql
    slkknqqtfelqetgvegicqttyvvqegyrtnemavvktkdlnncdhkvyktmgtayae
    rcptcqkmnknlrstavynyaifdepsgyiiksahseeiqqlsvfdikegnvviesrqkl
    ilegiqsapaasqaaslqnrgglmykfpssaitkmsslfvtkgknleseihtvlkhlven
    nqlsvhedapakflrltaflrnvdagvlqsiwhklhqqkdyrrwildavpamatseallf
    lkrtlaseqltsaeatqivastlsnqqatreslsyarellntsfirnrpilrktavlgyg
    slvfrycantvscpdellqplhdllsqssdrakeeeivlalkalgnagqpnsikkiqrfl
    pgqgksldeystrvqaeaimalrniakrdprkvqeivlpiflnvaikselrirscivffe
    skpsvalvsmvavrlrrepnlqvasfvysqmrslsrssnpefrdvaaacsvaikmlgskl
    drlgcryskavhvdtfnartmagvsadyfrinspsgplpravaakirgqgmgyasdivef
    glraeglqellydwksvpeerplasgyvkvhgqevvfaeldkkmqeqigavvskleqgmd
    vlltkgyvvsevrymqpvcigipmdlnllvsgvttnranlsasfsslpadmkladllatn
    ielrvaattsmsqhavaimglttdlakagmqthyktsaglgvngkiemnaresnfkaslk
    pfqqktvvvlstmesivfvrdpsgsrilpvlppkmtqkqihdimtarpvmrrkqscsksa
    alsskvcfsarlrnaafirnallykitgdyvskvyvqptsskaqitkvelelqag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lshB (B:)
    kyvpqrkpqtsrrhtpasssssssssssssssssssdsdmtvsaesfekhskpkvvivlr
    avradgkqqglqttlyygltsnglpkakivavelsdlsvwklcakfrlsahmkakaaigw
    gkncqqyramleastgnlqshpaarvdikwgrlpsslqraknallengapviasklemei
    mpkanqkhqvsvilaamtprrmniivklpkvtyfqqgillpftfpsprfwdrpegsqsds
    lpaqiasafsgivqdpvasacelneqslttfngaffnydmpescyhvlaqecssrppfiv
    likldserrislelqlddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lshB (B:)
    skpkvvivlravradgkqqglqttlyygltsnglpkakivavelsdlsvwklcakfrlsa
    hmkakaaigwgkncqqyramleastgnlqshpaarvdikwgrlpsslqraknallengap
    viasklemeimpkanqkhqvsvilaamtprrmniivklpkvtyfqqgillpftf