PDB entry 1ls9

View 1ls9 on RCSB PDB site
Description: Structure of the Cytochrome c6 from the Green Alga Cladophora glomerata
Deposited on 2002-05-17, released 2002-12-25
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-25, with a file datestamp of 2002-12-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.149
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1ls9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ls9A (A:)
  vdaelladgkkvfagncaachlggnnsvladktlkkdaiekyleggltleaikyqvnngk
  gampawadrldeddieavsnyvydqavnskw