PDB entry 1ls8

View 1ls8 on RCSB PDB site
Description: NMR structure of the unliganded Bombyx mori pheromone-binding protein at physiological pH
Class: transport protein
Keywords: Pheromone binding protein, BmPBP, BmPBPB, Solution structure, NMR, TRANSPORT PROTEIN
Deposited on 2002-05-17, released 2002-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pheromone binding protein
  Species: Bombyx mori [TaxId:7091]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P34174 (0-141)
  Domains in SCOPe 2.05: d1ls8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ls8A (A:)
  sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
  mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
  eihklnwapsmdvavgeilaev