PDB entry 1ls8

View 1ls8 on RCSB PDB site
Description: NMR structure of the unliganded Bombyx mori pheromone-binding protein at physiological pH
Class: transport protein
Keywords: Pheromone binding protein, BmPBP, BmPBPB, Solution structure, NMR
Deposited on 2002-05-17, released 2002-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone binding protein
    Species: Bombyx mori
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ls8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ls8A (A:)
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavgeilaev