PDB entry 1ls5

View 1ls5 on RCSB PDB site
Description: Crystal structure of plasmepsin IV from P. falciparum in complex with pepstatin A
Deposited on 2002-05-16, released 2002-06-12
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-12, with a file datestamp of 2002-06-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ls5a_
  • Chain 'B':
    Domains in SCOP 1.61: d1ls5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ls5A (A:)
    sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
    sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
    dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
    pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
    flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
    lgdpfmrkyftvfdyekesvgfavaknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ls5B (B:)
    sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
    sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
    dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
    pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
    flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
    lgdpfmrkyftvfdyekesvgfavaknl