PDB entry 1ls5

View 1ls5 on RCSB PDB site
Description: Crystal structure of plasmepsin IV from P. falciparum in complex with pepstatin A
Class: hydrolase/hydrolase inhibitor
Keywords: EUKARYOTIC ASPARTIC PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2002-05-16, released 2002-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin IV
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ls5a_
  • Chain 'B':
    Compound: plasmepsin IV
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ls5b_
  • Chain 'C':
    Compound: pepstatin
    Database cross-references and differences (RAF-indexed):
    • PDB 1LS5
  • Chain 'D':
    Compound: pepstatin
    Database cross-references and differences (RAF-indexed):
    • PDB 1LS5 (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ls5A (A:)
    sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
    sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
    dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
    pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
    flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
    lgdpfmrkyftvfdyekesvgfavaknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ls5B (B:)
    sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
    sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
    dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
    pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
    flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
    lgdpfmrkyftvfdyekesvgfavaknl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.