PDB entry 1ls2

View 1ls2 on RCSB PDB site
Description: fitting of ef-tu and trna in the low resolution cryo-em map of an ef- tu ternary complex (gdp and kirromycin) bound to e. coli 70s ribosome
Deposited on 2002-05-16, released 2002-06-26
The last revision prior to the SCOP 1.71 freeze date was dated 2002-06-26, with a file datestamp of 2002-06-26.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ls2a_
  • Chain 'B':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ls2A (A:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ls2A (A:)
    tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
    eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
    pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
    ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
    ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
    vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
    mddglrfaireggrtvgagvvakvls
    

  • Chain 'B':
    No sequence available.