PDB entry 1ls2

View 1ls2 on RCSB PDB site
Description: Fitting of EF-Tu and tRNA in the Low Resolution Cryo-EM Map of an EF-Tu Ternary Complex (GDP and Kirromycin) Bound to E. coli 70S Ribosome
Class: translation/RNA
Keywords: EF-Tu, ternary complex, cryo-EM, 70S E.coli ribosome, TRANSLATION/RNA COMPLEX
Deposited on 2002-05-16, released 2002-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 16.8 Å
R-factor: N/A
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ls2a_
  • Chain 'B':
    Compound: Phenylalanine transfer RNA
    Species: Saccharomyces cerevisiae [TaxId:4932]

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ls2A (A:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ls2A (A:)
    tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
    eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
    pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
    ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
    ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
    vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
    mddglrfaireggrtvgagvvakvls
    

  • Chain 'B':
    No sequence available.