PDB entry 1ls1

View 1ls1 on RCSB PDB site
Description: T. aquaticus Ffh NG Domain at 1.1A Resolution
Deposited on 2002-05-16, released 2002-11-16
The last revision prior to the SCOP 1.67 freeze date was dated 2002-11-16, with a file datestamp of 2002-11-16.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.137
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ls1A (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ls1A (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagglepfyperlagrilgmg