SCOPe 2.07: Structural Classification of Proteins

PDB entry 1lry

View 1lry on RCSB PDB site
Description: Crystal Structure of P. aeruginosa Peptide Deformylase Complexed with Antibiotic Actinonin
Class: hydrolase
Keywords: actinonin, inhibition, polypeptide deformylase, hydrolase
Deposited on 2002-05-16, released 2002-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Peptide deformylase
Species: Pseudomonas aeruginosa [TaxId:287]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9I7A8 (0-End)
Domains in SCOPe 2.07: d1lrya_
Heterogens: ZN, BB2, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1lryA (A:)
ailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivvm
dlsedkseprvfinpefepltedmdqyqegclsvpgfyenvdrpqkvrikaldrdgnpfe
evaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrqqa

Sequence, based on observed residues (ATOM records): (download)

>1lryA (A:)
ailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivvm
dlsedkseprvfinpefepltedmdqyqegclsvpgfyenvdrpqkvrikaldrdgnpfe
evaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrq