PDB entry 1lry

View 1lry on RCSB PDB site
Description: Crystal Structure of P. aeruginosa Peptide Deformylase Complexed with Antibiotic Actinonin
Deposited on 2002-05-16, released 2002-07-24
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-24, with a file datestamp of 2002-07-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1lrya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lryA (A:)
ailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivvm
dlsedkseprvfinpefepltedmdqyqegclsvpgfyenvdrpqkvrikaldrdgnpfe
evaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrq