PDB entry 1lrw

View 1lrw on RCSB PDB site
Description: Crystal structure of methanol dehydrogenase from P. denitrificans
Class: oxidoreductase
Keywords: Heavy subunits: 8-fold beta-propeller superbarrel, OXIDOREDUCTASE
Deposited on 2002-05-16, released 2003-08-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methanol dehydrogenase subunit 1
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12293 (0-599)
      • see remark 999 (443-449)
      • see remark 999 (451)
      • see remark 999 (489)
    Domains in SCOPe 2.05: d1lrwa_
  • Chain 'B':
    Compound: methanol dehydrogenase subunit 2
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lrwb_
  • Chain 'C':
    Compound: methanol dehydrogenase subunit 1
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12293 (0-599)
      • see remark 999 (443-449)
      • see remark 999 (451)
      • see remark 999 (489)
    Domains in SCOPe 2.05: d1lrwc_
  • Chain 'D':
    Compound: methanol dehydrogenase subunit 2
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lrwd_
  • Heterogens: CA, PQQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lrwA (A:)
    ndqlvelakdpanwvmtgrdynaqnysemtdinkenvkqlrpawsfstgvlhghegtplv
    vgdrmfihtpfpnttfaldlnepgkilwqnkpkqnptartvaccdvvnrglaywpgddqv
    kplifrtqldghivamdaetgetrwimensdikvgstltiapyvikdlvlvgssgaelgv
    rgyvtaydvksgemrwrafatgpdeelllaedfnapnphygqknlgletwegdawkiggg
    tnwgwyaydpevdlfyygsgnpapwnetmrpgdnkwtmaiwgreattgeakfayqktphd
    ewdyagvnvmmlseqedkqgqmrkllthpdrngivytldrtngdlisadkmddtvnwvke
    vqldtglpvrdpefgtrmdhkardicpsamgyhnqghdsydperkvfmlginhicmdwep
    fmlpyragqffvgatltmypgpkgdrgnasglgqikaydaisgemkwekmerfsvwggtm
    ataggltfyatldgfikardsdtgdllwkfklpsgvighpmtykhdgrqyvaimygvggw
    pgvglvfdladptaglgsvgafkrlqeftqmgggvmvfsldgespysdpnvgeyapgept
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lrwB (B:)
    ydgtnckapgncwepkpdypakvegskydpqhdpaelskqgeslavmdarnewrvwnmkk
    tgkfeydvkkidgydetkappae
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lrwC (C:)
    ndqlvelakdpanwvmtgrdynaqnysemtdinkenvkqlrpawsfstgvlhghegtplv
    vgdrmfihtpfpnttfaldlnepgkilwqnkpkqnptartvaccdvvnrglaywpgddqv
    kplifrtqldghivamdaetgetrwimensdikvgstltiapyvikdlvlvgssgaelgv
    rgyvtaydvksgemrwrafatgpdeelllaedfnapnphygqknlgletwegdawkiggg
    tnwgwyaydpevdlfyygsgnpapwnetmrpgdnkwtmaiwgreattgeakfayqktphd
    ewdyagvnvmmlseqedkqgqmrkllthpdrngivytldrtngdlisadkmddtvnwvke
    vqldtglpvrdpefgtrmdhkardicpsamgyhnqghdsydperkvfmlginhicmdwep
    fmlpyragqffvgatltmypgpkgdrgnasglgqikaydaisgemkwekmerfsvwggtm
    ataggltfyatldgfikardsdtgdllwkfklpsgvighpmtykhdgrqyvaimygvggw
    pgvglvfdladptaglgsvgafkrlqeftqmgggvmvfsldgespysdpnvgeyapgept
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lrwD (D:)
    ydgtnckapgncwepkpdypakvegskydpqhdpaelskqgeslavmdarnewrvwnmkk
    tgkfeydvkkidgydetkappae