PDB entry 1lrt

View 1lrt on RCSB PDB site
Description: crystal structure of ternary complex of tritrichomonas foetus inosine-5'-monophosphate dehydrogenase: structural characterization of nad+ site in microbial enzyme
Class: oxidoreductase
Keywords: ternary complex, alpha-beta barrel, flexible loop, flap, OXIDOREDUCTASE
Deposited on 2002-05-15, released 2003-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: -1.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus [TaxId:5724]
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lrta1
  • Chain 'B':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus [TaxId:5724]
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lrtb1
  • Chain 'C':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus [TaxId:5724]
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lrtc1
  • Chain 'D':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus [TaxId:5724]
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lrtd1
  • Heterogens: BOG, K, IMP, TAD, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lrtA (A:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lrtA (A:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkrylvgagintrdfrervpalv
    eagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfiki
    gigggsiceqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlalamg
    adfimlgryfarfeesptrkvtingsvmkeywgegssrarnweegvdsyvpyagklkdnv
    easlnkvkstmcncgaltipqlqskakitlvssvsive
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lrtB (B:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lrtB (B:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkrylvgagintrdfrervpalv
    eagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfiki
    gigggsiceqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlalamg
    adfimlgryfarfeesptrkvtingsvmkeywgegssrarnwdsyvpyagklkdnveasl
    nkvkstmcncgaltipqlqskakitlvssvsive
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lrtC (C:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lrtC (C:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkrylvgagintrdfrervpalv
    eagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfiki
    gigggsiceqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlalamg
    adfimlgryfarfeesptrkvtingsvmkeywgegssrarnwdsyvpyagklkdnveasl
    nkvkstmcncgaltipqlqskakitlvssvsive
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lrtD (D:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lrtD (D:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkrylvgagintrdfrervpalv
    eagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfiki
    gigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlal
    amgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwegvdsyvpyagklkd
    nveaslnkvkstmcncgaltipqlqskakitlvssvsive