PDB entry 1lrp

View 1lrp on RCSB PDB site
Description: comparison of the structures of cro and lambda repressor proteins from bacteriophage lambda
Class: DNA binding regulatory protein
Keywords: DNA binding regulatory protein
Deposited on 1987-12-04, released 1989-01-09
The last revision prior to the SCOP 1.73 freeze date was dated 1989-01-09, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lambda repressor
    Species: BACTERIOPHAGE LAMBDA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lrpa_
  • Chain 'B':
    Compound: lambda repressor
    Species: BACTERIOPHAGE LAMBDA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lrpb_
  • Chain 'C':
    Compound: lambda repressor
    Species: BACTERIOPHAGE LAMBDA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lrpc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lrpA (A:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lrpA (A:)
    kkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaa
    llakilkvsveefspsiareiyemyeavs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lrpB (B:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lrpB (B:)
    kkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaa
    llakilkvsveefspsiareiyemyeavs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lrpC (C:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lrpC (C:)
    kkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaa
    llakilkvsveefspsiareiyemyeavs