PDB entry 1lrp

View 1lrp on RCSB PDB site
Description: comparison of the structures of cro and lambda repressor proteins from bacteriophage lambda
Deposited on 1987-12-04, released 1989-01-09
The last revision prior to the SCOP 1.55 freeze date was dated 1989-01-09, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1lrp__
  • Chain 'B':
    no info in PDB for this chain
  • Chain 'C':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lrp_ (-)
    kkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaa
    llakilkvsveefspsiareiyemyeavs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.