PDB entry 1lrk

View 1lrk on RCSB PDB site
Description: Crystal Structure of Escherichia coli UDP-Galactose 4-Epimerase Mutant Y299C Complexed with UDP-N-acetylglucosamine
Class: isomerase
Keywords: epimerase, short chain dehydrogenase, galactosemia, ISOMERASE
Deposited on 2002-05-15, released 2002-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-glucose 4-epimerase
    Species: Escherichia coli [TaxId:562]
    Gene: GALE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09147 (0-337)
      • conflict (130)
      • engineered (298)
    Domains in SCOPe 2.08: d1lrka_
  • Heterogens: NA, NAD, UD1, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lrkA (A:)
mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
fsssatvygdnpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpacw
adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd