PDB entry 1lri

View 1lri on RCSB PDB site
Description: beta-cryptogein-cholesterol complex
Class: toxin
Keywords: cryptogein, cholesterol, sterol carrier protein
Deposited on 2002-05-15, released 2002-05-29
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.161
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-elicitin cryptogein
    Species: Phytophthora cryptogea
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15570 (0-97)
      • see remark 999 (5)
    Domains in SCOP 1.73: d1lria_
  • Heterogens: CL, CLR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lriA (A:)
    tactasqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
    kkivtlnppncdltvptsglvlnvysyangfsnkcssl