PDB entry 1lra

View 1lra on RCSB PDB site
Description: crystallographic study of glu 58 ala RNAse t1(asterisk)2'-guanosine monophosphate at 1.9 angstroms resolution
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on 1993-10-01, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease t1
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • conflict (24)
    • conflict (57)
  Domains in SCOPe 2.08: d1lraa_
• Heterogens: NA, 2GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lraA (A:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyawp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect