PDB entry 1lr8

View 1lr8 on RCSB PDB site
Description: Crystal structure of Fs1, the heparin-binding domain of follistatin, complexed with the heparin analogue D-myo-inositol hexasulphate (Ins6S)
Class: hormone/growth factor
Keywords: cystine-rich, D-myo-inositol hexasulphate, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2002-05-15, released 2003-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Follistatin
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21674 (1-73)
  Domains in SCOPe 2.08: d1lr8a1, d1lr8a2
• Heterogens: IHS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1lr8A (A:)
  metcenvdcgpgkkcrmnkknkprcvcapdcsnitwkgpvcgldgktyrnecallkarck
  eqpelevqyqgkck
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1lr8A (A:)
  etcenvdcgpgkkcrmnkknkprcvcapdcsnitwkgpvcgldgktyrnecallkarcke
  qpelevqyqgkck