PDB entry 1lr7

View 1lr7 on RCSB PDB site
Description: Crystal structure of Fs1, the heparin-binding domain of follistatin, complexed with the heparin analogue sucrose octasulphate (SOS)
Class: hormone/growth factor
Keywords: heparin-binding, cystine-rich, sucrose octasulphate
Deposited on 2002-05-15, released 2003-07-29
The last revision prior to the SCOP 1.75 freeze date was dated 2003-10-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Follistatin
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21674 (1-73)
  Domains in SCOP 1.75: d1lr7a1, d1lr7a2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1lr7A (A:)
  metcenvdcgpgkkcrmnkknkprcvcapdcsnitwkgpvcgldgktyrnecallkarck
  eqpelevqyqgkck
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1lr7A (A:)
  etcenvdcgpgkkcrmnkknkprcvcapdcsnitwkgpvcgldgktyrnecallkarcke
  qpelevqyqgkck