PDB entry 1lr6

View 1lr6 on RCSB PDB site
Description: Crystal structure of V45Y mutant of cytochrome b5
Class: electron transport
Keywords: cytochrome b5, trypsin-solubilized fragment, mutant v45y, crystal structure, electron transport
Deposited on 2002-05-15, released 2002-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (42)
    Domains in SCOPe 2.07: d1lr6a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lr6A (A:)
    avkyytleeiqkhnnskstwlilhykvydltkfleehpggeeylreqaggdatenfedvg
    hstdarelsktfiigelhpddr