PDB entry 1lqv

View 1lqv on RCSB PDB site
Description: Crystal structure of the Endothelial protein C receptor with phospholipid in the groove in complex with Gla domain of protein C.
Class: blood clotting
Keywords: Gla (gamma-carboxyglutamic acid) residues, phospholipid binding groove, Ca ion binding
Deposited on 2002-05-13, released 2002-06-19
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelial protein C receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lqva_
  • Chain 'B':
    Compound: Endothelial protein C receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lqvb_
  • Chain 'C':
    Compound: Vitamin-K dependent protein C
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04070 (0-32)
      • modified residue (5-6)
      • modified residue (13)
      • modified residue (15)
      • modified residue (18-19)
      • modified residue (24-25)
      • modified residue (28)
    Domains in SCOP 1.73: d1lqvc_
  • Chain 'D':
    Compound: Vitamin-K dependent protein C
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04070 (0-32)
      • modified residue (5-6)
      • modified residue (13)
      • modified residue (15)
      • modified residue (18-19)
      • modified residue (24-25)
      • modified residue (28)
    Domains in SCOP 1.73: d1lqvd_
  • Heterogens: NAG, NDG, CA, PTY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lqvA (A:)
    sqdasdglqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepe
    swartqsglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavng
    ssfvsfrperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae
    ntkgsqtsrsyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqvA (A:)
    glqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartq
    sglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsf
    rperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lqvB (B:)
    sqdasdglqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepe
    swartqsglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavng
    ssfvsfrperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae
    ntkgsqtsrsyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqvB (B:)
    lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs
    glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr
    peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqvC (C:)
    ansfleelrhsslerecieeicdfeeakeifqn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqvD (D:)
    ansfleelrhsslerecieeicdfeeakeifqn