PDB entry 1lqs

View 1lqs on RCSB PDB site
Description: crystal structure of human cytomegalovirus il-10 bound to soluble human il-10r1
Class: immune system
Keywords: interleukin 10, helix bundle, receptor complex, molecular recognition, structure mimic, IMMUNE SYSTEM
Deposited on 2002-05-13, released 2002-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: interleukin-10-like protein
    Species: Human herpesvirus 5 [TaxId:10359]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lqsl_
  • Chain 'M':
    Compound: interleukin-10-like protein
    Species: Human herpesvirus 5 [TaxId:10359]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lqsm_
  • Chain 'R':
    Compound: interleukin-10 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13651
      • engineered (28)
      • engineered (52)
      • engineered (88)
      • engineered (132)
      • engineered (155)
      • engineered (167)
    Domains in SCOPe 2.07: d1lqsr1, d1lqsr2
  • Chain 'S':
    Compound: interleukin-10 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13651
      • engineered (28)
      • engineered (52)
      • engineered (88)
      • engineered (132)
      • engineered (155)
      • engineered (167)
    Domains in SCOPe 2.07: d1lqss1, d1lqss2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1lqsL (L:)
    seeakpattttikntkpqcrpedyatrlqdlrvtfhrvkptlqreddysvwldgtvvkgc
    wgcsvmdwllrryleivfpagdhvypglktelhsmrstlesiykdmrqcpllgcgdksvi
    srlsqeaerksdngtrkglseldtlfsrleeylhsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqsL (L:)
    tkpqcrpedyatrlqdlrvtfhrvkptlqreddysvwldgtvvkgcwgcsvmdwllrryl
    eivfpagdhvypglktelhsmrstlesiykdmrqcpllgcgdksvisrlsqeaerksdng
    trkglseldtlfsrleeylhsr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1lqsM (M:)
    seeakpattttikntkpqcrpedyatrlqdlrvtfhrvkptlqreddysvwldgtvvkgc
    wgcsvmdwllrryleivfpagdhvypglktelhsmrstlesiykdmrqcpllgcgdksvi
    srlsqeaerksdngtrkglseldtlfsrleeylhsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqsM (M:)
    tkpqcrpedyatrlqdlrvtfhrvkptlqreddysvwldgtvvkgcwgcsvmdwllrryl
    eivfpagdhvypglktelhsmrstlesiykdmrqcpllgcgdksvisrlsqeaerksdng
    trkglseldtlfsrleeylhsr
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1lqsR (R:)
    hgtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsy
    dltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvdevtltvgsvnleihngfilg
    kiqlprpkmapaqdtyesifshfreyeiairkvpgqftfthkkvkheqfslltsgevgef
    cvqvkpsvasrsnkgmwskeecisltrqyftvtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqsR (R:)
    gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
    ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvdevtltvgsvnleihngfilgk
    iqlprpkmapaqdtyesifshfreyeiairkvpgqftfthkkvkheqfslltsgevgefc
    vqvkpsvasrsnkgmwskeecisltrq
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1lqsS (S:)
    hgtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsy
    dltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvdevtltvgsvnleihngfilg
    kiqlprpkmapaqdtyesifshfreyeiairkvpgqftfthkkvkheqfslltsgevgef
    cvqvkpsvasrsnkgmwskeecisltrqyftvtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqsS (S:)
    gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
    ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvdevtltvgsvnleihngfilgk
    iqlprpkmapaqdtyesifshfreyeiairkvpgqftfthkkvkheqfslltsgevgefc
    vqvkpsvasrsnkgmwskeecisltr