PDB entry 1lqp

View 1lqp on RCSB PDB site
Description: crystal structure of the fosfomycin resistance protein (fosa) containing bound substrate
Class: transferase
Keywords: potassium binding loop, manganese binding, TRANSFERASE
Deposited on 2002-05-11, released 2002-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.147
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable fosfomycin resistance protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lqpa_
  • Chain 'B':
    Compound: probable fosfomycin resistance protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lqpb_
  • Heterogens: K, MN, FCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lqpA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqpA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lqpB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqpB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa