PDB entry 1lqo

View 1lqo on RCSB PDB site
Description: Crystal Strutcure of the Fosfomycin Resistance Protein A (FosA) Containing Bound Thallium Cations
Deposited on 2002-05-11, released 2002-09-11
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-13, with a file datestamp of 2003-05-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1lqoa_
  • Chain 'B':
    Domains in SCOP 1.65: d1lqob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lqoA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqoA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lqoB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqoB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa