PDB entry 1lqk

View 1lqk on RCSB PDB site
Description: high resolution structure of fosfomycin resistance protein a (fosa)
Deposited on 2002-05-10, released 2002-09-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.138
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lqka_
  • Chain 'B':
    Domains in SCOP 1.63: d1lqkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqkA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqkB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa