PDB entry 1lqk

View 1lqk on RCSB PDB site
Description: High Resolution Structure of Fosfomycin Resistance Protein A (FosA)
Class: transferase
Keywords: potassium binding loop, manganese binding, TRANSFERASE
Deposited on 2002-05-10, released 2002-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable fosfomycin resistance protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lqka_
  • Chain 'B':
    Compound: probable fosfomycin resistance protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lqkb_
  • Heterogens: PO4, K, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lqkA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqkA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lqkB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqkB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa