PDB entry 1lqj

View 1lqj on RCSB PDB site
Description: escherichia coli uracil-DNA glycosylase
Class: hydrolase
Keywords: glycosylase, DNA repair, base excision, hydrolase
Deposited on 2002-05-10, released 2002-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.241
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12295 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1lqja1, d1lqja2
  • Chain 'B':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12295 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1lqjb1, d1lqjb2
  • Chain 'C':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12295 (1-228)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1lqjc1, d1lqjc2
  • Chain 'D':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lqjd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lqjA (A:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqjA (A:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lqjB (B:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqjB (B:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqjC (C:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lqjD (D:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqjD (D:)
    neltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilg
    qdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlll
    ntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhv
    lkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes