PDB entry 1lqi

View 1lqi on RCSB PDB site
Description: insecticidal alpha scorpion toxin isolated from the venom of scorpion leiurus quinquestriatus hebraeus, nmr, 29 structures
Class: neurotoxin
Keywords: neurotoxin, sodium channel inhibitor, signal
Deposited on 1996-06-17, released 1997-03-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insect toxin alpha
    Species: Leiurus quinquestriatus hebraeus [TaxId:6884]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1lqia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lqiA (A:)
mvrdayiaknyncvyecfrdaycnelctkngassgycqwagkygnacwcyalpdnvpirv
pgkcr