PDB entry 1lqg

View 1lqg on RCSB PDB site
Description: escherichia coli uracil-DNA glycosylase complex with uracil-DNA glycosylase inhibitor protein
Class: hydrolase/hydrolase inhibitor
Keywords: glycosylase, inhibitor, DNA repair, base excision, complex (hydrolase/inhibitor), hydrolase/hydrolase inhibitor complex
Deposited on 2002-05-10, released 2002-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.183
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lqga_
  • Chain 'B':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lqgb_
  • Chain 'C':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lqgc_
  • Chain 'D':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lqgd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lqgA (A:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqgA (A:)
    neltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilg
    qdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlll
    ntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhv
    lkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lqgB (B:)
    maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
    lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
    llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
    hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqgB (B:)
    aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
    gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
    lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
    vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lqgC (C:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqgC (C:)
    tgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalv
    iqdsngenkikml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lqgD (D:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqgD (D:)
    qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
    sngenkikml