PDB entry 1lqg

View 1lqg on RCSB PDB site
Description:
Deposited on 2002-05-10, released 2002-11-10
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-22, with a file datestamp of 2002-11-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.183
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1lqga_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1lqgb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1lqgc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1lqgd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqgA (A:)
    neltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilg
    qdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlll
    ntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhv
    lkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqgB (B:)
    aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
    gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
    lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
    vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqgC (C:)
    tgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalv
    iqdsngenkikml
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lqgD (D:)
    qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
    sngenkikml