PDB entry 1lqe

View 1lqe on RCSB PDB site
Description: crystal structure of trypsin in complex with 79.
Class: hydrolase
Keywords: Factor Xa inhibitor, enzyme-inhibitor complex, blood coagulation factor, serine proteinase, HYDROLASE
Deposited on 2002-05-10, released 2003-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.166
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lqea_
  • Heterogens: CA, SO4, IMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lqeA (A:)
    fiflallgaavafpvddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaah
    cyksgiqvrlgedninvvegneqfisasksivhpsynsntlnndimliklksaaslnsrv
    asislptscasagtqclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnm
    fcagyleggkdscqgdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqti
    asn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqeA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn