PDB entry 1lqb

View 1lqb on RCSB PDB site
Description: Crystal structure of a hydroxylated HIF-1 alpha peptide bound to the pVHL/elongin-C/elongin-B complex
Class: gene regulation
Keywords: protein-peptide complex, tumor suppressor, cancer, proteosomal degradation, ubiquitin, prolyl hydroxylation, GENE REGULATION
Deposited on 2002-05-09, released 2002-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongin b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lqba_
  • Chain 'B':
    Compound: elongin c
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lqbb_
  • Chain 'C':
    Compound: von hippel-lindau disease tumor supressor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lqbc_
  • Chain 'D':
    Compound: Hypoxia-inducible factor 1 alpha
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16665
      • modified residue (15)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lqbA (A:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqbA (A:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lqbB (B:)
    myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
    ftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqbB (B:)
    myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lqbC (C:)
    gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
    yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
    penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lqbC (C:)
    pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
    dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
    vrslyedledhpnvqkdlerltqeriahqr
    

  • Chain 'D':
    No sequence available.