PDB entry 1lq9

View 1lq9 on RCSB PDB site
Description: Crystal Structure of a Monooxygenase from the Gene ActVA-Orf6 of Streptomyces coelicolor Strain A3(2)
Class: oxidoreductase
Keywords: monooxygenase, aromatic polyketides, actinorhodin, dihydrokalafungin, streptomyces coelicolor
Deposited on 2002-05-09, released 2003-01-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-14, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.142
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actva-orf6 monooxygenase
    Species: Streptomyces Coelicolor
    Gene: ActVA - Orf6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lq9a_
  • Chain 'B':
    Compound: actva-orf6 monooxygenase
    Species: Streptomyces Coelicolor
    Gene: ActVA - Orf6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lq9b_
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lq9A (A:)
    aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv
    nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lq9B (B:)
    aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv
    nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps