PDB entry 1lq2

View 1lq2 on RCSB PDB site
Description: Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole
Class: hydrolase
Keywords: 2-domain fold, ligand-protein complex, HYDROLASE
Deposited on 2002-05-09, released 2003-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-d-glucan glucohydrolase isoenzyme exo1
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • GB AAD23382 (0-601)
      • conflict (319)
    Domains in SCOPe 2.07: d1lq2a1, d1lq2a2
  • Heterogens: NAG, IDD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lq2A (A:)
    dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
    prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
    pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
    qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
    amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
    sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
    npyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilvagsha
    dnlgyqcggwtiewqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksggfsya
    ivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaasdal
    vaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyglttn
    at