PDB entry 1lps

View 1lps on RCSB PDB site
Description: a structural basis for the chiral preferences of lipases
Class: hydrolase
Keywords: hydrolase, carboxylic esterase, crl
Deposited on 1995-01-05, released 1995-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.138
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Candida rugosa [TaxId:5481]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lpsa_
  • Heterogens: NAG, CA, MPC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lpsA (A:)
    melalalsliasvaaaptatlangdtitglnaiineaflgipfaeppvgnlrfkdpvpys
    gsldgqkftsygpscmqqnpegtyeenlpkaaldlvmqskvfeavspssedcltinvvrp
    pgtkaganlpvmlwifgggfevggtstfppaqmitksiamgkpiihvsvnyrvsswgfla
    gdeikaegsanaglkdqrlgmqwvadniaafggdptkvtifgesagsmsvmchilwndgd
    ntykgkplfragimqsgamvpsdavdgiygneifdllasnagcgsasdklaclrgvssdt
    ledatnntpgflaysslrlsylprpdgvnitddmyalvregkyanipviigdqndegtff
    gtsslnvttdaqareyfkqsfvhasdaeidtlmtaypgditqgspfdtgilnaltpqfkr
    isavlgdlgftlarryflnhytggtkysflskqlsglpvlgtfhsndivfqdyllgsgsl
    iynnafiafatdldpntagllvkwpeytsssqsgnnlmminalglytgkdnfrtagydal
    fsnppsffv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lpsA (A:)
    aptatlangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgsldgqkftsygpsc
    mqqnpegtyeenlpkaaldlvmqskvfeavspssedcltinvvrppgtkaganlpvmlwi
    fgggfevggtstfppaqmitksiamgkpiihvsvnyrvsswgflagdeikaegsanaglk
    dqrlgmqwvadniaafggdptkvtifgesagsmsvmchilwndgdntykgkplfragimq
    sgamvpsdavdgiygneifdllasnagcgsasdklaclrgvssdtledatnntpgflays
    slrlsylprpdgvnitddmyalvregkyanipviigdqndegtffgtsslnvttdaqare
    yfkqsfvhasdaeidtlmtaypgditqgspfdtgilnaltpqfkrisavlgdlgftlarr
    yflnhytggtkysflskqlsglpvlgtfhsndivfqdyllgsgsliynnafiafatdldp
    ntagllvkwpeytsssqsgnnlmminalglytgkdnfrtagydalfsnppsffv