PDB entry 1lps

View 1lps on RCSB PDB site
Description: a structural basis for the chiral preferences of lipases
Deposited on 1995-01-05, released 1995-02-14
The last revision prior to the SCOP 1.55 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.138
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1lps__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lps_ (-)
    aptatlangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgsldgqkftsygpsc
    mqqnpegtyeenlpkaaldlvmqskvfeavspssedcltinvvrppgtkaganlpvmlwi
    fgggfevggtstfppaqmitksiamgkpiihvsvnyrvsswgflagdeikaegsanaglk
    dqrlgmqwvadniaafggdptkvtifgesagsmsvmchilwndgdntykgkplfragimq
    sgamvpsdavdgiygneifdllasnagcgsasdklaclrgvssdtledatnntpgflays
    slrlsylprpdgvnitddmyalvregkyanipviigdqndegtffgtsslnvttdaqare
    yfkqsfvhasdaeidtlmtaypgditqgspfdtgilnaltpqfkrisavlgdlgftlarr
    yflnhytggtkysflskqlsglpvlgtfhsndivfqdyllgsgsliynnafiafatdldp
    ntagllvkwpeytsssqsgnnlmminalglytgkdnfrtagydalfsnppsffv