PDB entry 1lpq

View 1lpq on RCSB PDB site
Description: Human DNA Topoisomerase I (70 Kda) In Non-Covalent Complex With A 22 Base Pair DNA Duplex Containing an 8-oxoG Lesion
Class: isomerase/DNA
Keywords: protein-DNA complex, DNA damage, induced conformational change
Deposited on 2002-05-08, released 2002-08-16
The last revision prior to the SCOP 1.75 freeze date was dated 2002-09-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.14 Å
R-factor: 0.256
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (0-563)
      • engineered (521)
    Domains in SCOP 1.75: d1lpqa1, d1lpqa2, d1lpqa3
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*tp*tp*(8og)p*gp*ap*ap*ap*ap*ap*tp*tp*tp*tp*t)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*cp*ap*ap*gp*tp*cp*tp*tp*tp*tp*t)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lpqA (A:)
    kwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffa
    kmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmsk
    eeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimped
    iiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdw
    qkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadt
    vgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqpe
    ddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynr
    anravailcnhqrappktfeksmmnlqtkidakkeqladarrdlksakadakvmkdaktk
    kvveskkkavqrleeqlmklevqatdreenkqialgtsklnfldpritvawckkwgvpie
    kiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lpqA (A:)
    kwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffa
    kmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmsk
    eeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimped
    iiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdw
    qkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadt
    vgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqpe
    ddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynr
    anravailcnhqeksmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskk
    kavqrleeqlmklevqatdreenkqialgtsklnfldpritvawckkwgvpiekiynktq
    rekfawaidmadedyef
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.