PDB entry 1lpq

View 1lpq on RCSB PDB site
Description: human dna topoisomerase i (70 kda) in non-covalent complex with a 22 base pair dna duplex containing an 8-oxog lesion
Deposited on 2002-05-08, released 2002-08-16
The last revision prior to the SCOP 1.67 freeze date was dated 2002-08-16, with a file datestamp of 2002-08-16.
Experiment type: XRAY
Resolution: 3.14 Å
R-factor: 0.256
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lpqA (A:)
    kwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffa
    kmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmsk
    eeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimped
    iiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdw
    qkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadt
    vgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqpe
    ddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynr
    anravailcnhqrappktfeksmmnlqtkidakkeqladarrdlksakadakvmkdaktk
    kvveskkkavqrleeqlmklevqatdreenkqialgtsklnfldpritvawckkwgvpie
    kiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lpqA (A:)
    kwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffa
    kmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmsk
    eeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimped
    iiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdw
    qkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadt
    vgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqpe
    ddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynr
    anravailcnhqeksmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskk
    kavqrleeqlmklevqatdreenkqialgtsklnfldpritvawckkwgvpiekiynktq
    rekfawaidmadedyef