PDB entry 1lpo

View 1lpo on RCSB PDB site
Description: analogs of reaction intermediates identify a unique substrate binding site in candida rugosa lipase
Deposited on 1995-01-13, released 1995-04-20
The last revision prior to the SCOP 1.55 freeze date was dated 1995-04-20, with a file datestamp of 1995-04-27.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.149
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1lpo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lpo_ (-)
    aptatlangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgsldgqkftsygpsc
    mqqnpegtyeenlpkaaldlvmqskvfeavspssedcltinvvrppgtkaganlpvmlwi
    fgggfevggtstfppaqmitksiamgkpiihvsvnyrvsswgflagdeikaegsanaglk
    dqrlgmqwvadniaafggdptkvtifgesagsmsvmchilwndgdntykgkplfragimq
    sgamvpsdavdgiygneifdllasnagcgsasdklaclrgvssdtledatnntpgflays
    slrlsylprpdgvnitddmyalvregkyanipviigdqndegtffgtsslnvttdaqare
    yfkqsfvhasdaeidtlmtaypgditqgspfdtgilnaltpqfkrisavlgdlgftlarr
    yflnhytggtkysflskqlsglpvlgtfhsndivfqdyllgsgsliynnafiafatdldp
    ntagllvkwpeytsssqsgnnlmminalglytgkdnfrtagydalfsnppsffv