PDB entry 1lpl

View 1lpl on RCSB PDB site
Description: Structural Genomics of Caenorhabditis elegans: CAP-Gly domain of F53F4.3
Class: structural genomics, unknown function
Keywords: structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, UNKNOWN FUNCTION
Deposited on 2002-05-08, released 2002-05-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.22
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 25.4 kDa protein F53F4.3 in chromosome V
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: F53F4.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lpla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lplA (A:)
    sdklneeaaknimvgnrcevtvgaqmarrgevayvgatkfkegvwvgvkydepvgkndgs
    vagvryfdcdpkyggfvrpvdvkvgdfpelsidei